PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019195-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 318aa    MW: 35652.4 Da    PI: 4.7635
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019195-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.9e-131257146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde+l+++v+++G++ W++I ++  + Rt+k+c++rw +
    NNU_019195-RA 12 KGPWMAEEDEILLNYVNKYGPRGWSSIRAKGLLPRTGKSCRLRWVN 57
                     79*************************8776567**********87 PP

2Myb_DNA-binding422.2e-1368107344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+   +d+ +++G++ W++Ia +++ gRt++++k++w
    NNU_019195-RA  68 KFSAEEERVVIDLQARFGNK-WARIATYLP-GRTDNDVKNFW 107
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.892759IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-19860IPR009057Homeodomain-like
SuperFamilySSF466892.07E-2711107IPR009057Homeodomain-like
SMARTSM007172.0E-101161IPR001005SANT/Myb domain
PfamPF002492.3E-111257IPR001005SANT/Myb domain
CDDcd001679.69E-121459No hitNo description
PROSITE profilePS5129419.61660115IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-1861113IPR009057Homeodomain-like
SMARTSM007173.7E-1165113IPR001005SANT/Myb domain
CDDcd001672.79E-1068107No hitNo description
PfamPF002491.2E-1168107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEGKKDEMVV RKGPWMAEED EILLNYVNKY GPRGWSSIRA KGLLPRTGKS CRLRWVNKLK  60
PDLKTGCKFS AEEERVVIDL QARFGNKWAR IATYLPGRTD NDVKNFWSSR QKRLARILQT  120
PQPSKSQKNN GRTLVVHELP PLEEAPKLIS SIHVGEESST KDESDSPCYK ENSEMVKMMV  180
PLPDLVELNL LNFDTNLTQL EKKPCMELLP QFPFPQFPQH PLDLPLLLES QDLMVGVADT  240
NPLDVFSRQL APDDEPGCNG AQFAAGLPGF GSGGIAQDSC GCGRGYDNPV MPDSFFDDFP  300
TDMFDYDEQL PNPSSSEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-29121134103C-Myb DNA-Binding Domain
1msf_C5e-29121134103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010275492.10.0PREDICTED: transcription factor MYB29
TrEMBLD7SLV61e-108D7SLV6_VITVI; Putative uncharacterized protein
STRINGVIT_15s0021g02040.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-71MYB family protein